Protein coding transcript 200081

• Transcript: Ll_transcript_75092
• CDS coordinates: 3-440 (+)
• Peptide sequence: LFFDMLKGIDIMLHGVLSRHAIADKSMQGLETLNNSSRSSSTVLLGKTDDEDGKTTGGTDEGIFSIEGLQGSRRDILRFGSLGIAISCLVFTSSNWKAMQYASPKAVWNLFFGVTKPSMEEKEGNSRYDRIQQFVNYITDLESRL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_75092

• Blastp: Protein SUPPRESSOR OF QUENCHING 1, chloroplastic from Arabidopsis with 61.25% of identity
• Blastx: Protein SUPPRESSOR OF QUENCHING 1, chloroplastic from Arabidopsis with 71.35% of identity
• Eggnog: HAD-superfamily hydrolase subfamily IA variant 3(COG0637)
• Kegg: Link to kegg annotations (AT1G56500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422591.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;