Protein coding transcript 200087

• Transcript: Ll_transcript_75093
• CDS coordinates: 945-1448 (+)
• Peptide sequence: MHVLPDLDFLEKKYKDMPFVVVGVHSAKFDNEKDSEAIRNAVLRYDITHPVVNDGDMYLWRQLGINSWPTFAIIGPNGKLLAQLAGEGRKKDLDDFVEAALLFYGKQNMLDNTPITLNLEKDNDPRLLTSPLKFPGKLAVDVLNNRLFISDSNHNRIRGGRFAGWLL*
• ORF Type: complete

Annotations of Ll_transcript_75093

• Blastp: Protein SUPPRESSOR OF QUENCHING 1, chloroplastic from Arabidopsis with 80.89% of identity
• Blastx: Protein SUPPRESSOR OF QUENCHING 1, chloroplastic from Arabidopsis with 81.19% of identity
• Eggnog: HAD-superfamily hydrolase subfamily IA variant 3(COG0637)
• Kegg: Link to kegg annotations (AT1G56500)
• CantataDB: Link to cantataDB annotations (CNT0001568)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422600.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;