Transcript | Ll_transcript_75967 |
---|---|
CDS coordinates | 18-503 (+) |
Peptide sequence | MEKVREFLKASGSEEEYDAVSRINSLPSMRPSDNSSFYEHFILTGIRVDRVQPGFISCSFKIPPRLTEKNGKLVNGAIATLVDEVGGALVHVEGLPMNVSVDMSISFLSTAYVNDELEITSRLLGKKGGYSGTIVLLKNKATGELIAEGRHSLFGRHNSKM* |
ORF Type | complete |
Blastp | Acyl-coenzyme A thioesterase 13 from Pongo with 38.39% of identity |
---|---|
Blastx | Acyl-coenzyme A thioesterase 13 from Pongo with 38.39% of identity |
Eggnog | thioesterase Superfamily protein(COG2050) |
Kegg | Link to kegg annotations (100173179) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431754.1) |
Pfam | Thioesterase superfamily (PF03061.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer