Protein coding transcript 200147

• Transcript: Ll_transcript_75976
• CDS coordinates: 144-902 (+)
• Peptide sequence: MKKTTGPSLNQLNQRNKNSGFQDKGARNGTGSHNVKNHTVLTYLKSAVRRCVGLFLPGKRKTGSKVVQNDEKKNPDKVRELSSSTDLSSNNSNKGSSKSNFSHSYASSSSSSNQIGPGNFSFEEIYKATSKFSLDNKIGEGGFGTVYKGKLSNGPLVAVKRAKKDIQNKHLSEFKNEIYTLSKVEHLNLVRLHGYLEHGEEKIIVVEYVNNGTLREHLDGTRGRGLEIGERLDIAIDVAHAVTYLHMYTGVC*
• ORF Type: complete

Annotations of Ll_transcript_75976

• Blastp: Calmodulin-binding receptor-like cytoplasmic kinase 1 from Arabidopsis with 50.42% of identity
• Blastx: Calmodulin-binding receptor-like cytoplasmic kinase 1 from Arabidopsis with 68.15% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G58940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449894.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;