Protein coding transcript 200182

• Transcript: Ll_transcript_75881
• CDS coordinates: 1337-2059 (+)
• Peptide sequence: MSLKSHTGRATLLAEGCRGSLSEKIMKKYNLREKGGAEHQTYALGIKEVWEVDEQKHQPGTVLHTLGWPLDHKTYGGSFLYHMKDKQISIGLVVALNYQNPFMNPYEEFQKLKHHPAIKPLLEGGTVIQYGARTLNEGGIQSIPYPVFPGGAIIGCSAGFLNVPKIKGTHTAMKSGMLAAEATFGALHGSLGMDTYWDALRNSWIWQELYKARNYRPAFEYGLIPGLALSGLEHYIFRGRY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_75881

• Blastp: Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial from Arabidopsis with 81.12% of identity
• Blastx: Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial from Arabidopsis with 81.12% of identity
• Eggnog: geranylgeranyl reductase(COG0644)
• Kegg: Link to kegg annotations (AT2G43400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457832.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;