Protein coding transcript 20027

• Transcript: Ll_transcript_417861
• CDS coordinates: 1488-1832 (+)
• Peptide sequence: MRLSWALVHSRKKEDVQRGIAMLETSLGNDKSPLHQREKIYLLAVGYYRSNDYGRSRELLGQCLEVAPDWRQAQSLNKIVEDRIAKDGVIGIGITATGVALIVGGIAAALARKN*
• ORF Type: complete

Annotations of Ll_transcript_417861

• Blastp: Mitochondrial fission 1 protein A from Arabidopsis with 66.67% of identity
• Blastx: Mitochondrial fission 1 protein A from Arabidopsis with 62.5% of identity
• Eggnog: fission 1(ENOG4111PPH)
• Kegg: Link to kegg annotations (AT3G57090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437054.1)
• Pfam: Fis1 N-terminal tetratricopeptide repeat (PF14852.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;