Protein coding transcript 200279

• Transcript: Ll_transcript_76478
• CDS coordinates: 145-990 (+)
• Peptide sequence: MSFREDSAENRDLQKPFLHTGSWYKLGTRQSSVMSSTQAMRDGSVSVLFCVLIAALGPIQFGFTSGYSSPTQQAVISDLNLSISEFSLFGSLSNVGAMVGAIASGQIAEYVGRKGSLMIASIPNIIGWLAISFAKDSSFLFMGRLLEGFGVGIISYVVPVYIAEIAPQNMRGTLGSVNQLSVTIGIMIAYVLGLFVNWRVLAILGILPCTILIPGLFFIPESPRWLAKMGMTEEFESSLQVLRGFDTDISVEVHEIKVFSSFWCGFMNFANQITCMIGSIC*
• ORF Type: complete

Annotations of Ll_transcript_76478

• Blastp: Sugar transporter ERD6-like 6 from Arabidopsis with 81.4% of identity
• Blastx: Sugar transporter ERD6-like 6 from Arabidopsis with 81.4% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G75220)
• CantataDB: Link to cantataDB annotations (CNT0002863)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446727.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;