Protein coding transcript 200555

• Transcript: Ll_transcript_76034
• CDS coordinates: 3-473 (+)
• Peptide sequence: EISDETDRETGRTKQISTVPIHLSIYSPNVVNLTLVDLPGLTKIAVEGQSDSIVQDIESMVRSYIEKPNCIILAISPANQDLATSDAIKISREVDPTGERTIGVLTKIDLMDKGTDAVDILEGRAFKLKFPWIGVVNRSQQDINKNVDMIAARRRER
• ORF Type: internal

Annotations of Ll_transcript_76034

• Blastp: Dynamin-related protein 5A from Soja with 94.9% of identity
• Blastx: Dynamin-related protein 5A from Soja with 94.9% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (100037461)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422463.1)
• Pfam: Dynamin family (PF00350.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;