Protein coding transcript 200566

• Transcript: Ll_transcript_76064
• CDS coordinates: 108-890 (+)
• Peptide sequence: MAPKRGVKAPVAAAKKKPVAEKTNPLFEKRPKQFGIGGALPPKRDLTRFVKWPKTVQIQRKKRILKQRLKVPPALNQFTKTLDKNLATSLFKILLKYRPEDKAEKKERLLKRAQAEADGKPVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKLEIPYCIVKGKARLGTVVHKKTASVLCLTTVKNEDKLEFSRVLEAIKANFNDKYDEYRKKWGGGIMGSKSQAKTKAKERIIAKEAAQRLN*
• ORF Type: complete

Annotations of Ll_transcript_76064

• Blastp: 60S ribosomal protein L7a-2 from Arabidopsis with 85.38% of identity
• Blastx: 60S ribosomal protein L7a-2 from Arabidopsis with 88.24% of identity
• Eggnog: (ribosomal) protein(COG1358)
• Kegg: Link to kegg annotations (AT3G62870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454255.1)
• Pfam: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;