Protein coding transcript 200570

• Transcript: Ll_transcript_76067
• CDS coordinates: 47-739 (+)
• Peptide sequence: MAPKRGVKAPAVAKKKTETVTNPLFEKRPKQFGIGGALPPKRDLTRFVKWPKTVQIQRKKRILKQRLKVPPALNQFTKTLDKNLATSLFKILLKYRPEDKAEKKERLLKRAQAEADGKPVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKLEIPYCIVKGKARLGTVVHKKTASVLCLTTVKNEDKLEFSRILEAIKANFNDKYDGYRKKWGG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_76067

• Blastp: 60S ribosomal protein L7a-2 from Oryza sativa with 88.74% of identity
• Blastx: 60S ribosomal protein L7a-2 from Oryza sativa with 88.6% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (4345279)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450956.1)
• Pfam: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;