Transcript | Ll_transcript_76044 |
---|---|
CDS coordinates | 2-538 (+) |
Peptide sequence | EKRPKQCGIGGALPPKRDLTRFVKWPKTVQIQRKKRILKQRLKVPPALNQFTKTLDKNLATNLFKLLLKYRPEDKAEKKERLLKRAQSEADGKPVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKARLGTVVHKKTASVLCLTTVKNEDK |
ORF Type | internal |
Blastp | 60S ribosomal protein L7a-2 from Oryza sativa with 90.5% of identity |
---|---|
Blastx | 60S ribosomal protein L7a-2 from Oryza sativa with 90.5% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (4345279) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020222713.1) |
Pfam | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer