Protein coding transcript 200574

• Transcript: Ll_transcript_76049
• CDS coordinates: 47-517 (+)
• Peptide sequence: MAPKRGVKAPAVAKKKTETVTNPLFEKRPKQFGIGGALPPKRDLTRFVKWPKTVQLQRKKRILKQRLKVPPALNQFTKTLDKNLATSLFKILLKYRPEAKAEKTERLLKRAQAEADGKPVEAKKPIVVKYGLNHVTYLIEQVVFYIMFLIAAPFNY*
• ORF Type: complete

Annotations of Ll_transcript_76049

• Blastp: 60S ribosomal protein L7a-2 from Oryza sativa with 85.82% of identity
• Blastx: 60S ribosomal protein L7a-2 from Oryza sativa with 78.72% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (4345279)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450956.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;