| Transcript | Ll_transcript_76050 |
|---|---|
| CDS coordinates | 108-569 (+) |
| Peptide sequence | MAPKRGVKAPVAAAKKKPVAEKTNPLFEKRPKQFGIGGALPPKRDLTRFVKWPKTVQIQRKKRILKQRLKVPPALNQFTKTLDKNLATSLFKILLKYRPEDKAEKKERLLKRAQAEADGKTVEAKKPIVVKYGLNHVTYLIEQVGFSFIVLCL* |
| ORF Type | complete |
| Blastp | 60S ribosomal protein L7a-2 from Oryza sativa with 80.92% of identity |
|---|---|
| Blastx | 60S ribosomal protein L7a-2 from Oryza sativa with 85.38% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (4345279) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020214693.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer