Transcript | Ll_transcript_76052 |
---|---|
CDS coordinates | 47-823 (+) |
Peptide sequence | MAPKRGVKAPAVAKKKTETVTNPLFEKRPKQFGIGGALPPKRDLTRFVKWPKTVQLQRKKRILKQRLKVPPALNQFTKTLDKNLATSLFKILLKYRPEAKAEKTERLLKRAQAEADGKPVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKLEIPYCIVKGKARLGTVVHKKTASVLCLTTVKNEDKLEFSRILEAIKANFNDKYDEYRKKWGGGIMGSKSQAKTKAKERLIAKEAAQRLN* |
ORF Type | complete |
Blastp | 60S ribosomal protein L7a-2 from Oryza sativa with 86.82% of identity |
---|---|
Blastx | 60S ribosomal protein L7a-2 from Oryza sativa with 86.67% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (4345279) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450956.1) |
Pfam | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer