Protein coding transcript 200582

• Transcript: Ll_transcript_76742
• CDS coordinates: 411-1220 (+)
• Peptide sequence: MESWIYVSEEKGYGSNDTLSPPNTVGRSKSSILGWELKTPCSFSNDLLALGHQNIDNHQCFEDLGYPEMLGKNLYDDLDGGHGARITATTVIAAVPNPFSARGDCNFRLPNSIGSDSFIDLKLGRFVDHGEAIDAAFSKGAPIMSSSESPIPSKRVRASGLRSQTVYCQVYGCNKDLSSCKDYHKRHRVCEVHSKTSTVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQMGINSGRAGRLLQPCGGNNTHSEIRS*
• ORF Type: complete

Annotations of Ll_transcript_76742

• Blastp: Squamosa promoter-binding-like protein 6 from Arabidopsis with 64.49% of identity
• Blastx: Squamosa promoter-binding-like protein 6 from Arabidopsis with 64.49% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG41120IC)
• Kegg: Link to kegg annotations (AT1G69170)
• CantataDB: -
• Mirbase: mtr-MIR156a (MI0001752)
• Ncbi protein: Link to NCBI protein (XP_019438972.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;