Protein coding transcript 200588

• Transcript: Ll_transcript_76744
• CDS coordinates: 416-1615 (+)
• Peptide sequence: MDWNLKSPSLDLTEVDQASTFPNMETMDEGSSRFGVYSTKGEFSVDLKLGQVGNFGTESMLSKPKGAASDAGLSKMASTLASGSSKRARAFNNGNHTVTCLVDGCNSDLSNCRDYHRRHKVCELHSKTPQVTIGGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQPEPLTRSSSFLSNYQGTQLLPFSGSQIYSSNTMVNPGWSGGVVTSCADVRLHSHHQHQQQQVNFIDKQDLFLGSSPISYKEGKQLAYLQGDHNPTVTLNNQNTHHLQTLLRTNPYSESSGGLRCKMFCDDSLTSSVHDSPCALSLLSSPQTHNNSGNGLNQMVQPHSASLMQPLGLSLHDNNSLESVDPVLDPNGSDHCSSMYNIGSNGSQGSDVPQLFPFQWE*
• ORF Type: complete

Annotations of Ll_transcript_76744

• Blastp: Squamosa promoter-binding-like protein 13B from Arabidopsis with 41.42% of identity
• Blastx: Squamosa promoter-binding-like protein 13B from Arabidopsis with 40.93% of identity
• Eggnog: Squamosa promoter-binding-like protein(ENOG410YD0Z)
• Kegg: Link to kegg annotations (AT5G50570)
• CantataDB: -
• Mirbase: bdi-MIR156j (MI0029151)
• Ncbi protein: Link to NCBI protein (XP_019464709.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;