Protein coding transcript 200628

• Transcript: Ll_transcript_76716
• CDS coordinates: 1590-2525 (+)
• Peptide sequence: MYLCVFCYRNKAAIVKVGAIHKMLALIDSPDSSVCEAIVANFLGLSALDSNKPIIGSSGAIPVLVRTLQDLDNKSSTQVKQDALRALYNLSITPTNISFILETDLVSFLVNSTGDMEVSERILSILSNLVSTPEGRKAISAVRDAIPIMMDVLSWTDSPQCQEKASYILMIMAHKSYGDRHTMIEAGIASPLLELTLLGTQLAQKRASRILECLRLDKGKQVSRRYRGNLGATVSAPICGSSSSFTKTEGRSLEDEDMMSEEKKAVKQLVQQSLQNNMRKIVKRANLHHDFVPSDRFTSFTSSSTSKSLAL*
• ORF Type: complete

Annotations of Ll_transcript_76716

• Blastp: U-box domain-containing protein 13 from Arabidopsis with 34.27% of identity
• Blastx: U-box domain-containing protein 13 from Arabidopsis with 34.27% of identity
• Eggnog: Ubox domain-containing protein(ENOG4110352)
• Kegg: Link to kegg annotations (AT3G46510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417584.1)
• Pfam: Armadillo/beta-catenin-like repeat (PF00514.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;