Protein coding transcript 20063

• Transcript: Ll_transcript_281786
• CDS coordinates: 798-1268 (+)
• Peptide sequence: MVKAKIKESKSKDEAESLKFTQKNLINKIYTDSAEAKIPSVLDYVGTVIEAGCKFLIFAHHQPMIDSIHEFLLKKKVGCIRIDGGTPAASRQQLVTEFQEKDAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRVHRIGQVSSVNIY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_281786

• Blastp: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Xenopus with 55% of identity
• Blastx: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Xenopus with 55% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (734728)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020228091.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;