Transcript | Ll_transcript_75395 |
---|---|
CDS coordinates | 2-439 (+) |
Peptide sequence | LLAHAAAVRVYKTMFQESQKGSIGITLVANWYLPLSDTKLDQKAAERAIDFMYGWYMDPLTSGDYPQSMRSLVRTRLPKFTAEQSKLLIGSFDFVGLNYYSSTYASDAPHLSNAKPSYVTDALFNPAFERNGKPIGIKIASDWLYV |
ORF Type | internal |
Blastp | Beta-glucosidase 24 from Oryza sativa with 57.53% of identity |
---|---|
Blastx | Beta-glucosidase 24 from Oryza sativa with 57.53% of identity |
Eggnog | beta-glucosidase(COG2723) |
Kegg | Link to kegg annotations (4340890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413926.1) |
Pfam | Glycosyl hydrolase family 1 (PF00232.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer