Protein coding transcript 200647

• Transcript: Ll_transcript_75395
• CDS coordinates: 2-439 (+)
• Peptide sequence: LLAHAAAVRVYKTMFQESQKGSIGITLVANWYLPLSDTKLDQKAAERAIDFMYGWYMDPLTSGDYPQSMRSLVRTRLPKFTAEQSKLLIGSFDFVGLNYYSSTYASDAPHLSNAKPSYVTDALFNPAFERNGKPIGIKIASDWLYV
• ORF Type: internal

Annotations of Ll_transcript_75395

• Blastp: Beta-glucosidase 24 from Oryza sativa with 57.53% of identity
• Blastx: Beta-glucosidase 24 from Oryza sativa with 57.53% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: Link to kegg annotations (4340890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413926.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;