Protein coding transcript 200651

• Transcript: Ll_transcript_75409
• CDS coordinates: 142-537 (+)
• Peptide sequence: MQESQKGSIGITLVANWYLPLSDTKLDQKAAERAIDFMYGWYMDPLTSGDYPQSMRSLVRTRLPKFTAEQSKLLIGSFDFVGLNYYSSTYASDAPHLSNAKPSYVTDALFNPAFERNGKPIGIKIASDWLYV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_75409

• Blastp: Cyanogenic beta-glucosidase from Trifolium with 60.31% of identity
• Blastx: Cyanogenic beta-glucosidase from Trifolium with 58.82% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413926.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;