Protein coding transcript 200652

• Transcript: Ll_transcript_75410
• CDS coordinates: 30-944 (+)
• Peptide sequence: MAFRMFLLVSLFTLVTTSVSITLAEEATAPILDVASLNRSSFPKGFIFGTASASYQYEGAAKEGGRGESIWDTFTHKYPDKIQDRSNGDVANDEYHRYKEDVGIMKYMNLDAYRFSISWSRILPDGKLSGGVNQEGIKYYNNLINELLANGIQPLVTLFHWDLPQSLEDEYGGFLSPLIVKDFQDYAELCFKEFGDRVKFWVTLNEPWSYSSNGYTNGRMAPGRCSSWVNPNCTGGDSSIEPYIVTHYQLLAHSAAVRVYKTKFQESQKGSIGITLVANWYLPLSDTKLDQKAAERAIDFMYGW*
• ORF Type: complete

Annotations of Ll_transcript_75410

• Blastp: Non-cyanogenic beta-glucosidase from Trifolium with 65.32% of identity
• Blastx: Cyanogenic beta-glucosidase from Trifolium with 72.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000679)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454131.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;