Protein coding transcript 200658

• Transcript: Ll_transcript_75400
• CDS coordinates: 1459-2109 (+)
• Peptide sequence: MLLAHAAAVNVYRTKYQTSQKGLIGITLIADWFLPLTDTKLDQQAAQRALDFMFGWYMEPLTKGSYPKSMQSLVKNRLPKFSSDQIKLLIGSFDFIGLNYYTSSYAANAPPSSGLRPNYLTDSHVNLLNERNGTSIGPTAASFWLYVYPRGILDVLLYIKHKYNNPVIYITENGVDELDDPNLSLEEALNDTYRIDYHYQHLYYLQIAIKNGVNVKG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_75400

• Blastp: Isoflavonoid 7-O-beta-apiosyl-glucoside beta-glycosidase from Dalbergia with 58.06% of identity
• Blastx: Beta-glucosidase 12 from Oryza sativa with 61.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436806.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;