Protein coding transcript 200662

• Transcript: Ll_transcript_75406
• CDS coordinates: 89-649 (+)
• Peptide sequence: MVLNNGLFILRVLVALVLSMNTSKVTSTEAFVGVDPILDVSSLNRQSFPPGFIFGAGSSSYQFEGAAMEGGRGPSVWDTFTHKYPDKIQDRSNGDIAVDQYHRYKEDVNIMKDMNMDAYRFSISWSRILPKGKISGGVNKEGINYYNNLINEVLAKGLQPFVTIFHWDLPQALEEEYGGFLSPSIV*
• ORF Type: complete

Annotations of Ll_transcript_75406

• Blastp: Non-cyanogenic beta-glucosidase from Trifolium with 69.83% of identity
• Blastx: Beta-glucosidase 12 from Oryza sativa with 55.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436806.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;