Protein coding transcript 200677

• Transcript: Ll_transcript_76182
• CDS coordinates: 398-1144 (+)
• Peptide sequence: MYLMEVDRVLRPGGYWILSGPPINWKTYYQTWQRSKEDLKAEQRKIEELAESLCWEKKYEKGDIAIWRKKINAKSCLRKSPKFCDSDNADDVWYKKMEDCKTPYPEVTSKSEVAGGELKKFPARLFAVPPRIAKGNIPGVTADSYQEDNKLWKMHLSAYKKMNRLIGTTRYRNVMDMNAGLGGFAAALESQKSWVMNVVPTIADNTLGVVYERGLIGIYHDWCEGFSTYPRTYDLIHANGLFSLYQDT*
• ORF Type: complete

Annotations of Ll_transcript_76182

• Blastp: Probable methyltransferase PMT14 from Arabidopsis with 73.39% of identity
• Blastx: Probable methyltransferase PMT14 from Arabidopsis with 72.91% of identity
• Eggnog: Methyltransferase(ENOG41117FM)
• Kegg: Link to kegg annotations (AT4G18030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433221.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;