Protein coding transcript 200690

• Transcript: Ll_transcript_76231
• CDS coordinates: 317-835 (+)
• Peptide sequence: MEGSGENWPCDSDLDVGDYVKDLYFDVDDESDHNTRRRNQEFSERLLALSDTIPGLNKRMDNTSILDKASNYVKQLQQRVRELEQVESKSGTSSCTEVKSYYYYEGNDNIIPEIRVRVLHKEVLIIIHCEKQKGIMVKIMSHLENLHLSIVNSSVLPFGKSTLDITIIAQMGD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_76231

• Blastp: Transcription factor bHLH19 from Arabidopsis with 41.72% of identity
• Blastx: Transcription factor bHLH19 from Arabidopsis with 41.72% of identity
• Eggnog: Helix-loop-helix DNA-binding domain(ENOG411144M)
• Kegg: Link to kegg annotations (AT2G22760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431912.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;