| Transcript | Ll_transcript_321069 |
|---|---|
| CDS coordinates | 169-465 (+) |
| Peptide sequence | MASSSYSNSPCAACKFLRRRCMPDCIFSQYFPPEEPQKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVIRL |
| ORF Type | 3prime_partial |
| Blastp | LOB domain-containing protein 25 from Arabidopsis with 84.38% of identity |
|---|---|
| Blastx | LOB domain-containing protein 25 from Arabidopsis with 84.38% of identity |
| Eggnog | lob domain-containing protein(ENOG4111E81) |
| Kegg | Link to kegg annotations (AT3G27650) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447459.1) |
| Pfam | Lateral organ boundaries (LOB) domain (PF03195.13) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer