Transcript | Ll_transcript_75540 |
---|---|
CDS coordinates | 3484-3894 (+) |
Peptide sequence | MLRSFSMQMMESLVTSLPTESQKPALEDKSNAANNTKRPAPSTGGCRVEGHVRVKKVPGNLIISARSDAHSFDASQMNMSHVINHLSFGRKITARTMTDVKILIPHIGSSSDRLKGRSFINTHDLEGNITVSLIFI* |
ORF Type | complete |
Blastp | Protein disulfide-isomerase 5-4 from Arabidopsis with 59.2% of identity |
---|---|
Blastx | Protein disulfide-isomerase 5-3 from Arabidopsis with 45.88% of identity |
Eggnog | Endoplasmic reticulumgolgi intermediate compartment protein(ENOG410XP7X) |
Kegg | Link to kegg annotations (AT4G27080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413485.1) |
Pfam | Endoplasmic reticulum vesicle transporter (PF07970.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer