Protein coding transcript 200718

• Transcript: Ll_transcript_75543
• CDS coordinates: 3789-4199 (+)
• Peptide sequence: MLRSFSMQMMESLVTSLPTESQKPALEDKSNAANNTKRPAPSTGGCRVEGHVRVKKVPGNLIISARSDAHSFDASQMNMSHVINHLSFGRKITARTMTDVKILIPHIGSSSDRLKGRSFINTHDLEGNITVSLIFI*
• ORF Type: complete

Annotations of Ll_transcript_75543

• Blastp: Protein disulfide-isomerase 5-4 from Arabidopsis with 59.2% of identity
• Blastx: Protein disulfide-isomerase 5-4 from Arabidopsis with 78.98% of identity
• Eggnog: Endoplasmic reticulumgolgi intermediate compartment protein(ENOG410XP7X)
• Kegg: Link to kegg annotations (AT4G27080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413484.1)
• Pfam: Endoplasmic reticulum vesicle transporter (PF07970.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;