Protein coding transcript 20073

• Transcript: Ll_transcript_281779
• CDS coordinates: 75-1304 (+)
• Peptide sequence: MWVYHIHKCCKCNFSWLLQAIAVAACIQDSWPVLIIAPSSLRLQWASMIQQWLNIPSSDILVVLSQSGGSNRGGFNIVSSSGKSRIHLTGLFNIISYDLVPKLQNMLIASDFKVVIADESHFLKNAQAKRTAASLPVIKKAKYAILLSGTPALSRPIELFKQLEALYPDVYKNVHEYGNRYCKGGVFGVFQGASNHDELHNLMKATVMIRRLKKDVLSELPVKRRQQVFLDLADKDMKQINSLFRELEMVKAKIKESKSKDEAESLKFTQKNLINKIYTDSAEAKIPSVLDYVGTVIEAGCKFLIFAHHQPMIDSIHEFLLKKKVGCIRIDGGTPAASRQQLVTEFQEKDAIKAAVLSIKAGGVGLTLTAASTVIFAELSWTPGDLIQAEDRVHRIGQVLLTFGVVIER*
• ORF Type: complete

Annotations of Ll_transcript_281779

• Blastp: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Homo with 44.56% of identity
• Blastx: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Homo with 44.56% of identity
• Eggnog: helicase(COG0553)
• Kegg: Link to kegg annotations (50485)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419020.1)
• Pfam: SNF2 family N-terminal domain (PF00176.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;