Transcript | Ll_transcript_281780 |
---|---|
CDS coordinates | 75-935 (+) |
Peptide sequence | MWVYHIHKCCKCNFSWLLQAIAVAACIQDSWPVLIIAPSSLRLQWASMIQQWLNIPSSDILVVLSQSGGSNRGGFNIVSSSGKSRIHLTGLFNIISYDLVPKLQNMLIASDFKVVIADESHFLKNAQAKRTAASLPVIKKAKYAILLSGTPALSRPIELFKQLEALYPDVYKNVHEYGNRYCKGGVFGVFQGASNHDELHNLMKATVMIRRLKKDVLSELPVKRRQQVFLDLADKDMKQINSLFREQILSNIVIRASCIEPSSSYIDDKFLTKIMSFHFEVVIFVD* |
ORF Type | complete |
Blastp | DNA annealing helicase and endonuclease ZRANB3 from Bos with 41.95% of identity |
---|---|
Blastx | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 from Xenopus with 53.94% of identity |
Eggnog | helicase(COG0553) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419023.1) |
Pfam | SNF2 family N-terminal domain (PF00176.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer