Protein coding transcript 200777

• Transcript: Ll_transcript_76577
• CDS coordinates: 2042-2830 (+)
• Peptide sequence: MSAATAASSFIITTLRPSHPPWHSSIYNHIYSSPKSNSNSNSKGIFVATAVTHNNNNELSLSSSAYNSPSSITDDLGDVTIFRASGEPVTLKSLMWDEAVEEGLTVVALLRHFGCPCCWELASTLKESKARFDSAGVKLIAIGVGTPTKARILAQRLPFPMDCLYADPDRKAYNVLNLYYGFGRTFFNPASAKVFSRFDALQKAVKNYTIEATPDDTSGVLQQGGMFVFRGKQLLYGRKDEGTGDHAPLDDIFDVCCKAPLA*
• ORF Type: complete

Annotations of Ll_transcript_76577

• Blastp: Thioredoxin-like protein AAED1, chloroplastic from Arabidopsis with 30.15% of identity
• Blastx: Elongation factor P from Ruegeria with 38.95% of identity
• Eggnog: AhpC/TSA family(ENOG410XVW9)
• Kegg: Link to kegg annotations (AT2G37240)
• CantataDB: Link to cantataDB annotations (CNT0002107)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415339.1)
• Pfam: AhpC/TSA family (PF00578.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;