Transcript | Ll_transcript_76567 |
---|---|
CDS coordinates | 2265-3053 (+) |
Peptide sequence | MSAATAASSFIITTLRPSHPPWHSSIYNHIYSSPKSNSNSNSKGIFVATAVTHNNNNELSLSSSAYNSPSSITDDLGDVTIFRASGEPVTLKSLMWDEAVEEGLTVVALLRHFGCPCCWELASTLKESKARFDSAGVKLIAIGVGTPTKARILAQRLPFPMDCLYADPDRKAYNVLNLYYGFGRTFFNPASAKVFSRFDALQKAVKNYTIEATPDDTSGVLQQGGMFVFRGKQLLYGRKDEGTGDHAPLDDIFDVCCKAPLA* |
ORF Type | complete |
Blastp | Thioredoxin-like protein AAED1, chloroplastic from Arabidopsis with 30.15% of identity |
---|---|
Blastx | Elongation factor P from Bradyrhizobium with 41.13% of identity |
Eggnog | AhpC/TSA family(ENOG410XVW9) |
Kegg | Link to kegg annotations (AT2G37240) |
CantataDB | Link to cantataDB annotations (CNT0002107) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415339.1) |
Pfam | AhpC/TSA family (PF00578.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer