Protein coding transcript 20078

• Transcript: Ll_transcript_281784
• CDS coordinates: 75-935 (+)
• Peptide sequence: MWVYHIHKCCKCNFSWLLQAIAVAACIQDSWPVLIIAPSSLRLQWASMIQQWLNIPSSDILVVLSQSGGSNRGGFNIVSSSGKSRIHLTGLFNIISYDLVPKLQNMLIASDFKVVIADESHFLKNAQAKRTAASLPVIKKAKYAILLSGTPALSRPIELFKQLEALYPDVYKNVHEYGNRYCKGGVFGVFQGASNHDELHNLMKATVMIRRLKKDVLSELPVKRRQQVFLDLADKDMKQINSLFREQILSNIVIRASCIEPSSSYIDDKFLTKIMSFHFEVVIFVD*
• ORF Type: complete

Annotations of Ll_transcript_281784

• Blastp: DNA annealing helicase and endonuclease ZRANB3 from Bos with 41.95% of identity
• Blastx: DNA annealing helicase and endonuclease ZRANB3 from Bos with 41.95% of identity
• Eggnog: helicase(COG0553)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419023.1)
• Pfam: SNF2 family N-terminal domain (PF00176.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;