Protein coding transcript 200784

• Transcript: Ll_transcript_76572
• CDS coordinates: 236-892 (+)
• Peptide sequence: MSVMLKRLSNSKLLKLISSSSSSSLPCFFIPSRGLRVSGSDVRVGNVIEKQGRIYEVLKVDHSHEGRGKATVKVELRDIAHGNKAIQRIATDEDIERVYVQEKSFMYMCTDQDGTVVLMDSTTFDQIEVSLDLFGKNSSYLQDGMKVKVQFYDDKPFSASVPKRVTCIVKKEIAATPRNKKVVLENGGLTVEVPPHIVAGDAIVVSTENDSYLERAKA*
• ORF Type: complete

Annotations of Ll_transcript_76572

• Blastp: Elongation factor P from Ruegeria with 38.95% of identity
• Blastx: Elongation factor P from Ruegeria with 38.95% of identity
• Eggnog: Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity)(COG0231)
• Kegg: Link to kegg annotations (SPO1244)
• CantataDB: Link to cantataDB annotations (CNT0002107)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414690.1)
• Pfam: Elongation factor P (EF-P) KOW-like domain (PF08207.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;