| Transcript | Ll_transcript_281785 |
|---|---|
| CDS coordinates | 3-368 (+) |
| Peptide sequence | LEALYPDVYKNVHEYGNRYCKGGVFGVFQGASNHDELHNLMKATVMIRRLKKDVLSELPVKRRQQVFLDLADKDMKQINSLFREVIQHIHCIVLDKGNFIQILLSYYLSYLCNVAAMTIFF* |
| ORF Type | 5prime_partial |
| Blastp | DNA annealing helicase and endonuclease ZRANB3 from Bos with 43.96% of identity |
|---|---|
| Blastx | DNA annealing helicase and endonuclease ZRANB3 from Bos with 43.96% of identity |
| Eggnog | helicase(COG0553) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020228091.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer