Protein coding transcript 200790

• Transcript: Ll_transcript_76120
• CDS coordinates: 484-1044 (+)
• Peptide sequence: MILITSGFLNIFLGSYKYGGKDFKVSSSPSGPSLNECKSLALKALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDGAAEAGFADQNSPVAIVRPADFEDAAKKACQTKLQDAKSSYPHTEDGNLPYICMDLVYQYTLLVNGFGIYPWQEITLVKKVKYDDALVEAAWPLGSAIEAVSST*
• ORF Type: complete

Annotations of Ll_transcript_76120

• Blastp: Apyrase 1 from Arabidopsis with 70.69% of identity
• Blastx: Apyrase 1 from Arabidopsis with 70.69% of identity
• Eggnog: Ectonucleoside triphosphate diphosphohydrolase(COG5371)
• Kegg: Link to kegg annotations (AT3G04080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458467.1)
• Pfam: GDA1/CD39 (nucleoside phosphatase) family (PF01150.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;