Transcript | Ll_transcript_76109 |
---|---|
CDS coordinates | 2-682 (+) |
Peptide sequence | GDNPYVKEMFLRGTKYYLYVHSYLRYGLLAARAEILKASDDAENPCILAGFDGSYKYGGKDFKVSSSPSGPSLNECKSLALKALKVNESTCTHMKCTFGGIWNGGGGDGRKNLFVASFFFDRAAEAGFADPNSPVVKVRPVDFEDAAKQACQTKLADVKSTYQHVEEGNRPYLCMDLVYQYTLLVVGFGLDPWQEITLVKKVKYRNALVEAAWPLGSAIEVVSSLQ* |
ORF Type | 5prime_partial |
Blastp | Apyrase 2 from Arabidopsis with 71.43% of identity |
---|---|
Blastx | Apyrase 2 from Arabidopsis with 71.43% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT5G18280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453153.1) |
Pfam | GDA1/CD39 (nucleoside phosphatase) family (PF01150.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer