Protein coding transcript 200824

• Transcript: Ll_transcript_75763
• CDS coordinates: 383-808 (+)
• Peptide sequence: MKQFRRCQRFLILSLLSLSVIAPLVFVSRRFNVLSPHGRTAFLDDFSTVTYRTDPLKLNAIEQEGAGKLEEPKQVVYEEKDFGSRGNTSAEKINDSVESRHEVHRNIFLERNESQHDKGQDQVAQHKGLSSLDGDKVNTNS*
• ORF Type: complete

Annotations of Ll_transcript_75763

• Blastp: Probable galacturonosyltransferase 6 from Arabidopsis with 45.05% of identity
• Blastx: Probable galacturonosyltransferase 6 from Arabidopsis with 38.33% of identity
• Eggnog: Galacturonosyltransferase(ENOG410YA0P)
• Kegg: Link to kegg annotations (AT1G06780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456475.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;