Protein coding transcript 200878

• Transcript: Ll_transcript_75208
• CDS coordinates: 422-925 (-)
• Peptide sequence: MSDRLGKYGHFILIKHRYSAGSIAEVFVKEVIRLHGVPISIVSDRDPTFMSHFWQELFRLQGTTLKMSPAYHPESDGQTEFLNRTLETYLRYVSSKQPKAWAECIPWADYWYNTTFQSAAHCTPFEVVYGRPPPSLSKFVSGEVLVEAVAQDLMNRDEALKQLKFHL*
• ORF Type: complete

Annotations of Ll_transcript_75208

• Blastp: Transposon Tf2-8 polyprotein from Schizosaccharomyces with 35.56% of identity
• Blastx: Transposon Ty3-G Gag-Pol polyprotein from Saccharomyces with 30.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC13D1.01c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017438495.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;