Protein coding transcript 2009

• Transcript: Ll_transcript_321082
• CDS coordinates: 164-739 (+)
• Peptide sequence: MAFSAPLWSSTLLPNKTTTFPSRLSPSIPKPSSTFAFPPLSIAATADFDTTTIAVIGGGSVAALAAVLSLTDPERRRKLQAEEVGGGDKEVVREYFNSTGFQRWKKIYGETEDVNRVQLDIRIGHAKTVEKTIEMLKDGGSLRGVTVCDAGCGTGSLSIPLAKEGAIVSATDISAAMVAEAEKQVHFLFIY*
• ORF Type: complete

Annotations of Ll_transcript_321082

• Blastp: Magnesium protoporphyrin IX methyltransferase, chloroplastic from Arabidopsis with 73.21% of identity
• Blastx: Magnesium protoporphyrin IX methyltransferase, chloroplastic from Arabidopsis with 76.64% of identity
• Eggnog: Non-specific O-methyltransferase that catalyzes the 2 O- methylation steps in the ubiquinone biosynthetic pathway (By similarity)(COG2227)
• Kegg: Link to kegg annotations (AT4G25080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463149.1)
• Pfam: Methyltransferase domain (PF13649.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;