Transcript | Ll_transcript_75448 |
---|---|
CDS coordinates | 426-1190 (+) |
Peptide sequence | MEKLETKHGRGEEYNGSMSHQDSDWEPLTYSPTSNVFGINSTGCSSSRSSTSSCAGCCCSNITEENDDEEECLDDWEAMADALAANENQQHQNPCPDSPISPIVQTGPRDGSSSGATNSIVESARLVPWASGNTQAWRADDAFRPRSLPNLSKQLSMPNPDRYCGGGSPWTRPTMSSSCPICCEDLDLTDSSFLPCLCGFRLCLFCHKRILEDDGRCPGCRKPYEYEPVETEAKVAGGSLTICLARSCSLIERS* |
ORF Type | complete |
Blastp | Putative general negative regulator of transcription C16C9.04c from Schizosaccharomyces with 50.94% of identity |
---|---|
Blastx | Putative general negative regulator of transcription C16C9.04c from Schizosaccharomyces with 50.94% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC16C9.04c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464367.1) |
Pfam | RING/Ubox like zinc-binding domain (PF14570.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer