Protein coding transcript 200962

• Transcript: Ll_transcript_75472
• CDS coordinates: 1-363 (+)
• Peptide sequence: DAAMRACVDAAPVIDGRRANCNLASLGVQRSKPSTPKHGGGIRNFRVMGSFQTGFGGGGLGSAFASAATFPPYAVQQGIPYNLYGYSPYSPDYSYPTSYYSVYGAAAAAAQYPVYGSGGMM
• ORF Type: internal

Annotations of Ll_transcript_75472

• Blastp: Probable RNA-binding protein ARP1 from Arabidopsis with 62.86% of identity
• Blastx: Probable RNA-binding protein ARP1 from Arabidopsis with 64.71% of identity
• Eggnog: RNA binding motif protein(ENOG4111PGT)
• Kegg: Link to kegg annotations (AT3G54770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412835.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;