Transcript | Ll_transcript_75482 |
---|---|
CDS coordinates | 290-1234 (+) |
Peptide sequence | MTPINLAGQFGDTTYTKVFVGGLAWETQKETMNKYFEQFGEILEAVVITDKATGRSKGYGFVTFREPDAAMRACVDASPVIDGRRANCNLASLGVQRSKPSTPKHGGGGRNFRVMGSFQTGFGGGGVGSAFASAPTFPHYAIQQGMPYNLYGYSPYSTDYTYPTSYYSVYGGATGGGVQYPVYGSGGMMTGGGGGGGAAFYPYVQYGGDGSSGGYTSSGGQGGYGAVSYQPHLLQYSHIAAASTAAHGGYAQHYATPISLPPSPAIQSGLICTPFLFLFLFPFPFPFNTHHFCYIFYALSILTSLTVCFAVPQA* |
ORF Type | complete |
Blastp | Probable RNA-binding protein ARP1 from Arabidopsis with 63.37% of identity |
---|---|
Blastx | Probable RNA-binding protein ARP1 from Arabidopsis with 63.37% of identity |
Eggnog | RNA binding motif protein(ENOG4111PGT) |
Kegg | Link to kegg annotations (AT3G54770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454402.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer