Protein coding transcript 201046

• Transcript: Ll_transcript_75582
• CDS coordinates: 230-562 (+)
• Peptide sequence: MEENRQKLVGVTNHLCNMSMDKRTNSVTDSHRSLDLLTKRQKEAVDMHNGVHESPGDRESNGYLEDNHGSTAVLLGSNVAVKNAVRPIKLPAVTRLPPYTTWIFLDRFSE*
• ORF Type: complete

Annotations of Ll_transcript_75582

• Blastp: Histone-lysine N-methyltransferase CLF from Arabidopsis with 42.06% of identity
• Blastx: Histone-lysine N-methyltransferase CLF from Arabidopsis with 44.29% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT2G23380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444689.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;