Protein coding transcript 201082

• Transcript: Ll_transcript_76220
• CDS coordinates: 202-720 (+)
• Peptide sequence: MDHDNSECQAPPEGPVLCINNCGFFGSAATMNMCSKCHKDMMLKQEQAKLAASSIGNIMNGSSSSIASEPVVVAIVDIPVNSIEPKTISVQPSLASASEESGEAKPKGGPKRCDSCNKRVGLTGFNCRCGNIFCAVHRYSDKHDCPFDYRSAGQDAIAKANPVVKSEKLDKI*
• ORF Type: complete

Annotations of Ll_transcript_76220

• Blastp: Zinc finger A20 and AN1 domain-containing stress-associated protein 8 from Oryza sativa with 64.37% of identity
• Blastx: Zinc finger A20 and AN1 domain-containing stress-associated protein 8 from Oryza sativa with 64.37% of identity
• Eggnog: zinc finger(ENOG4111UWC)
• Kegg: Link to kegg annotations (4341520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436581.1)
• Pfam: A20-like zinc finger (PF01754.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;