Protein coding transcript 201130

• Transcript: Ll_transcript_76294
• CDS coordinates: 2-577 (+)
• Peptide sequence: MNQGHVSTVVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLFEALCARPVLNPSLPKEQVSLADWALICKRKGTLEDIIDPYIKGKINPESLKKFADTAEKCLSDHGIDRPSMNDLLWNLEFALNLQENPDGSTKGAARVIDESEFEDIRLGNNDMANHYKNLSLGSEHELSSNEEDSSENSHQGDKEKCYR*
• ORF Type: complete

Annotations of Ll_transcript_76294

• Blastp: Receptor-like protein kinase ANXUR2 from Arabidopsis with 85.61% of identity
• Blastx: Receptor-like protein kinase ANXUR2 from Arabidopsis with 85.61% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G28680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425109.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;