Protein coding transcript 20121

• Transcript: Ll_transcript_282574
• CDS coordinates: 112-663 (+)
• Peptide sequence: MGAMMSRFWFMLFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTNPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWATYYRGTHAVIAVIDSSDRERISIMKDELFRLLGHDDLQSSVILVFANKQDIKDAMTPAEITDALSLHSIKNHDWHIQACCALSGEGLYDGLGWIASRVSGKAST*
• ORF Type: complete

Annotations of Ll_transcript_282574

• Blastp: ADP-ribosylation factor-like protein 5 from Dictyostelium with 59.67% of identity
• Blastx: ADP-ribosylation factor-like protein 5 from Dictyostelium with 59.67% of identity
• Eggnog: GTP-binding Protein(COG1100)
• Kegg: Link to kegg annotations (DDB_G0271942)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464877.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;