Protein coding transcript 201301

• Transcript: Ll_transcript_125231
• CDS coordinates: 2151-3263 (+)
• Peptide sequence: MDVNHAGVNEMQYTSGDVSKLMTYSPTTDRIKLQPFVSNAFPNGFPIKKNIAEKLDMCKKLLKFAKKSLNKGTTSHYGIEACNEVLNGQSHVVGPALKYECLCIRAALLLQRKWKNDAYMAIRDCYAARKIDNSSYKPLYYMSEALSQLHRHKEALDFAVASHILAPSISEVSERVENVKKDIASAEFEKSIKANHGSSMFHTRGGRILSLNDMLYRSEANSDASQDGPISERDDSDYDEELELDFETSISGDEGHDDESNILHGSLNLRIHQRDDSGENASANGLCESPSSSSQNNGACYQAEAVVDMRQRFVGHCNVGTDIKQASFLGQRGEYVASGSDDGRWFIWEKKTGRLIKMLNGDESVVNCIQC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_125231

• Blastp: WD and tetratricopeptide repeats protein 1 from Mus with 55.22% of identity
• Blastx: WD and tetratricopeptide repeats protein 1 from Homo with 37.61% of identity
• Eggnog: WD and tetratricopeptide repeats(ENOG410XWAR)
• Kegg: Link to kegg annotations (230796)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438517.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;