Transcript | Ll_transcript_125231 |
---|---|
CDS coordinates | 2151-3263 (+) |
Peptide sequence | MDVNHAGVNEMQYTSGDVSKLMTYSPTTDRIKLQPFVSNAFPNGFPIKKNIAEKLDMCKKLLKFAKKSLNKGTTSHYGIEACNEVLNGQSHVVGPALKYECLCIRAALLLQRKWKNDAYMAIRDCYAARKIDNSSYKPLYYMSEALSQLHRHKEALDFAVASHILAPSISEVSERVENVKKDIASAEFEKSIKANHGSSMFHTRGGRILSLNDMLYRSEANSDASQDGPISERDDSDYDEELELDFETSISGDEGHDDESNILHGSLNLRIHQRDDSGENASANGLCESPSSSSQNNGACYQAEAVVDMRQRFVGHCNVGTDIKQASFLGQRGEYVASGSDDGRWFIWEKKTGRLIKMLNGDESVVNCIQC |
ORF Type | 3prime_partial |
Blastp | WD and tetratricopeptide repeats protein 1 from Mus with 55.22% of identity |
---|---|
Blastx | WD and tetratricopeptide repeats protein 1 from Homo with 37.61% of identity |
Eggnog | WD and tetratricopeptide repeats(ENOG410XWAR) |
Kegg | Link to kegg annotations (230796) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438517.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer