Protein coding transcript 201312

• Transcript: Ll_transcript_125246
• CDS coordinates: 132-608 (+)
• Peptide sequence: MSSSSSYSYRVAIPGSSIEDEASESSSSSSFSTSSLNFSSGNPRIEETRGLMHLFRHDPNSSLSSSPPPPLPVERKPLVCVVGVPNHMTYADFCQFSGSFIHHILEMRIVRLDGMEDYYSVLIRFNDQDSTDSFYKHYNGRRFSSLEQRIVWLECSVF*
• ORF Type: complete

Annotations of Ll_transcript_125246

• Blastp: BRCA1-associated protein from Mus with 36.96% of identity
• Blastx: BRCA1-associated protein from Mus with 46.77% of identity
• Eggnog: BRCA1 associated protein(ENOG410XSS2)
• Kegg: Link to kegg annotations (72399)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436338.1)
• Pfam: BRCA1-associated protein 2 (PF07576.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;