Protein coding transcript 201335

• Transcript: Ll_transcript_124820
• CDS coordinates: 2287-2868 (+)
• Peptide sequence: MQTTYENFRYQYDKKRNPYNKGTLQNICETFCSSIPVSMHNFRSFVVEDEHMTVESMTPNIMEGMMSSKEKIDIEMGSMRAEDGGMPIPKLLQNFDFDNFEHAMKFEDEEGQSVDEEGQPSFDPLYSIEDDVKDSARTSVATVLNFHSITEDEKKETLQSSNNGANVGEPSERPINADGTNAIEETDHRNRSS*
• ORF Type: complete

Annotations of Ll_transcript_124820

• Blastp: Probable protein S-acyltransferase 4 from Arabidopsis with 56.44% of identity
• Blastx: Probable protein S-acyltransferase 4 from Arabidopsis with 70.27% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G56930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458028.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;